Proteintech, 67762-1-Ig, Human Ig lambda chain Monoclonal antibody

Size: 20ul / 150ul The Human Ig lambda chain (67762-1-Ig) by Proteintech is a Monoclonal antibody targeting Human Ig lambda chain in WB, IHC, IF-P, ELISA applications with reactivity to human samples 67762-1-Ig targets Human Ig lambda chain in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human appendicitis tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:5000-1:20000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information This antibody detects Lambda chain of human immunoglobulin. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag14783 Product name: Recombinant human IGLC1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-234 aa of BC007782 Sequence: MAWTVLLLGLLSHCTGSGTSYVLTQPASVSVAPGQTARITCGGSNLGSKSVNWYQLRPGQAPILVVYENKERPAGIPERLSALTSEETATLTISSVVAGDEADYFCQVWDTTSQQYVFGTGTQVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS Predict reactive species Full Name: immunoglobulin lambda constant 1 (Mcg marker) Calculated Molecular Weight: 233 aa, 25 kDa Observed Molecular Weight: ~25 kDa GenBank Accession Number: BC007782 Gene Symbol: IgG Lambda Light Chain Gene ID (NCBI): 3537 RRID: AB_2918530 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.