Iright
BRAND / VENDOR: Proteintech

Proteintech, 67763-1-Ig, GPX4 Monoclonal antibody

CATALOG NUMBER: 67763-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GPX4 (67763-1-Ig) by Proteintech is a Monoclonal antibody targeting GPX4 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig, rabbit, canine, chicken, zebrafish, hamster samples 67763-1-Ig targets GPX4 in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit, canine, chicken, zebrafish, hamster samples. Tested Applications Positive WB detected in: EC109 cells, HEK-293 cells, NCCIT cells, pig brain tissue, rabbit testis tissue, Hela cells, HepG2 cells, Jurkat cells, HSC-T6 cells, 4T1 cells, ATDC-5 cells, MDCK cells, CHO cells, Chicken brain tissue, Zebrafish tissue, human platelet tissue, rat brain tissue, mouse brain tissue, rabbit brain tissue, rat testis tisssue, mouse testis tissue Positive IHC detected in: human liver cancer tissue, mouse testis tissue, rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse testis tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information GPX4 (Phospholipid hydroperoxide glutathione peroxidase, mitochondrial) protects cells against membrane lipid peroxidation and cell death. Required for normal sperm development and male fertility.It has two isforms about 20KDa and 22KDa, respectively. GPX4 is a monomer,but it has a tendency to form higher mass oligomers (PMID:17630701). It presents primarily in testis. Specification Tested Reactivity: human, mouse, rat, pig, rabbit, canine, chicken, zebrafish, hamster Cited Reactivity: human, mouse, rat, pig, rabbit, chicken, bovine, sheep, goat, duck Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30650 Product name: Recombinant human GPX4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 107-197 aa of BC021567 Sequence: KQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF Predict reactive species Full Name: glutathione peroxidase 4 (phospholipid hydroperoxidase) Observed Molecular Weight: 20-23 kDa GenBank Accession Number: BC021567 Gene Symbol: GPX4 Gene ID (NCBI): 2879 RRID: AB_2909469 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P36969 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924