Proteintech, 67764-1-Ig, ADARB1 Monoclonal antibody

Size: 20ul / 150ul The ADARB1 (67764-1-Ig) by Proteintech is a Monoclonal antibody targeting ADARB1 in WB, ELISA applications with reactivity to Human, Mouse, Rat samples 67764-1-Ig targets ADARB1 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: 4T1 cells, HeLa cells, HSC-T6 cells, HepG2 cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information ADARB1 (Double-stranded RNA-specific editase 1) is also named as ADAR2, DRADA2, RED1 and belongs to the ADAR family. It catalyses the deamination of adenosine to inosine at the GluR2 Q/R site in the pre-mRNA encoding the critical subunit of AMPA receptors. This protein has some isoforms with the molecular weight from 77 kDa to 81 kDa and 7 kDa, but it can be detected a very strong band at 50 kDa in addition to a predicted band at 75 kDa as the result of western blot, while ADARB1 has several alternative splice variants (PMID:23103828). Specification Tested Reactivity: Human, Mouse, Rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17852 Product name: Recombinant human ADARB1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 176-392 aa of BC065545 Sequence: LFNGFETPDKAEPPFYVGSNGDDSFSSSGDLSLSASPVPASLAQPPLPALPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALAAIFNLHLDQTPSRQPIPSEGLQLHLPQVLADAVSRLVLGKFGDLTDNFSSPHARRKVLAGVVMTTGTDVKDAKVISVSTGTKCINGEYMSDRGLALND Predict reactive species Full Name: adenosine deaminase, RNA-specific, B1 (RED1 homolog rat) Calculated Molecular Weight: 741 aa, 81 kDa Observed Molecular Weight: 70 kDa, 80 kDa GenBank Accession Number: BC065545 Gene Symbol: ADARB1 Gene ID (NCBI): 104 RRID: AB_2918531 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P78563 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.