Proteintech, 67772-1-Ig, GALE Monoclonal antibody

Size: 20ul / 150ul The GALE (67772-1-Ig) by Proteintech is a Monoclonal antibody targeting GALE in WB, ELISA applications with reactivity to Human, Mouse, Rat, Pig, Rabbit samples 67772-1-Ig targets GALE in WB, ELISA applications and shows reactivity with Human, Mouse, Rat, Pig, Rabbit samples. Tested Applications Positive WB detected in: U2OS cells, A375 cells, HEK-293T cells, HeLa cells, K-562 cells, 4T1 cells, rat liver tissue, pig liver tissue, rabbit liver tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information GALE(Galactowaldenase) is also named as UDP-glucose 4-epimerase, UDP-galactose 4-epimerase, and belongs to the sugar epimerase family. UDP-galactose 4-epimerase catalyzes the interconversion of UDP-glucose and UDP-galactose during normal galactose metabolism. In humans, deficiencies in this enzyme lead to the complex disorder referred to as epimerase-deficiency galactosemia(PMID:10801319).It can exsit as a homodimer(PMID:8931134). Specification Tested Reactivity: Human, Mouse, Rat, Pig, Rabbit Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6571 Product name: Recombinant human GALE protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-348 aa of BC050685 Sequence: MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA Predict reactive species Full Name: UDP-galactose-4-epimerase Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC050685 Gene Symbol: GALE Gene ID (NCBI): 2582 RRID: AB_2918537 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q14376 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.