Iright
BRAND / VENDOR: Proteintech

Proteintech, 67773-1-Ig, TMEM74 Monoclonal antibody

CATALOG NUMBER: 67773-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TMEM74 (67773-1-Ig) by Proteintech is a Monoclonal antibody targeting TMEM74 in WB, ELISA applications with reactivity to Human samples 67773-1-Ig targets TMEM74 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: LNCaP cells, L02 cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Transmembrane protein 74 (TMEM74), plays an essential role in autophagy during cell starvation and other stress conditions. TMEM74 is localized to the lysosome and autophagosome. It has been rreported that TMEM74-induced autophagy may be associated with PI3K signal transduction. (PMID: 19029833, 18294959) Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag22359 Product name: Recombinant human TMEM74 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-187 aa of BC030710 Sequence: MELHYLAKKSNQADLCDARDWSSRGLPGDQADTAATRAALCCQKQCASTPRATEMEGSKLSSSPASPSSSLQNSTLQPDAFPPGLLHSGNNQITAERKVCNCCSQELETSFTYVDKNINLEQRNRSSPSAKGHNHPGELGWENPNEWSQEAAISLISEEEDDTSSEATSSGKSIDYGFISAILFLVT Predict reactive species Full Name: transmembrane protein 74 Calculated Molecular Weight: 305 aa, 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC030710 Gene Symbol: TMEM74 Gene ID (NCBI): 157753 RRID: AB_2918538 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q96NL1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924