Product Description
Size: 20ul / 150ul
The KLHL25 (67774-1-Ig) by Proteintech is a Monoclonal antibody targeting KLHL25 in WB, IHC, ELISA applications with reactivity to human, mouse samples
67774-1-Ig targets KLHL25 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: HEK-293 cells, HT-29 cells, HepG2 cells, NCCIT cells, MOLT-4 cells, Raji cells, Ramos cells, Daudi cells
Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:1000-1:6000
Immunohistochemistry (IHC): IHC : 1:300-1:1200
Specification
Tested Reactivity: human, mouse
Host / Isotype: Mouse / IgG1
Class: Monoclonal
Type: Antibody
Immunogen: CatNo: Ag27037 Product name: Recombinant human KLHL25 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 162-260 aa of BC028100 Sequence: RRLYEFSWRMCLVHFETVRQSEDFNSLSKDTLLDLISSDELETEDERVVFEAILQWVKHDLEPRKVHLPELLRSVRLALLPSDCLQEAVSSEALLMADE Predict reactive species
Full Name: kelch-like 25 (Drosophila)
Observed Molecular Weight: 66 kDa
GenBank Accession Number: BC028100
Gene Symbol: KLHL25
Gene ID (NCBI): 64410
RRID: AB_2918539
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein G purification
UNIPROT ID: Q9H0H3
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924