Proteintech, 67810-1-Ig, LARP1 Monoclonal antibody

Size: 20ul / 150ul The LARP1 (67810-1-Ig) by Proteintech is a Monoclonal antibody targeting LARP1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 67810-1-Ig targets LARP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HCT 116 cells, HEK-293 cells, HSC-T6 cells, NIH/3T3 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29993 Product name: Recombinant human LARP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-283 aa of BC033856 Sequence: MPRKRKTRHSSNPPLESHVGWVMDSREHRPRTASISSSPSEGTPTVGSYGCTPQSLPKFQHPSHELLKENGFTQHVYHKYRRRCLNERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFKQLALEDAKEGYRYGLECLFRYYSYGLEKKFRLDIFKDFQEETVKDYEAGQLYGLEKFWAFLKYSKAKNLDIDPKLQEYLGKFRRLEDFRVDPPMGEEGNHKRHSVVAGGGGGEGRKRCPSQSSSRPAAMISQPPTPPTGQPVREDAKWTSQHSNTQTLGK Predict reactive species Full Name: La ribonucleoprotein domain family, member 1 Calculated Molecular Weight: 1096 aa, 124 kDa Observed Molecular Weight: 140-150 kDa GenBank Accession Number: BC033856 Gene Symbol: LARP1 Gene ID (NCBI): 23367 RRID: AB_2918573 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q6PKG0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.