Iright
BRAND / VENDOR: Proteintech

Proteintech, 67822-1-Ig, VAMP2 Monoclonal antibody

CATALOG NUMBER: 67822-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The VAMP2 (67822-1-Ig) by Proteintech is a Monoclonal antibody targeting VAMP2 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, Mouse, Rat, Pig, Rabbit samples 67822-1-Ig targets VAMP2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat, Pig, Rabbit samples. Tested Applications Positive WB detected in: rabbit brain tissue, pig brain tissue, rat brain tissue, mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U-87 MG cells, SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information VAMP2 (vesicle-associated membrane protein 2), also named as synaptobrevin 2, is a member of the SNARE (soluble NSF-attachment protein receptor) family proteins. Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP2, with a molecular mass of 15-19 kDa, consists of a short N-terminal sequence, a SNARE motif, and a C-terminal transmembrane region. It is required for fast calcium-triggered synaptic vesicle fusion. VAMP2 forms a stable complex with STX1 (syntaxin 1) and SNAP25 (synaptosomal-associated protein 25) during synaptic vesicle fusion (PMID: 16793874). It also forms a distinct complex with synaptophysin. VAMP2 is expressed in nervous system and some non-neuronal tissues, such as skeletal muscle (PMID: 18570252). Specification Tested Reactivity: Human, Mouse, Rat, Pig, Rabbit Host / Isotype: Mouse / IgG3 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17908 Product name: Recombinant human VAMP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-116 aa of BC002737 Sequence: MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST Predict reactive species Full Name: vesicle-associated membrane protein 2 (synaptobrevin 2) Calculated Molecular Weight: 13 kDa Observed Molecular Weight: 19 kDa GenBank Accession Number: BC002737 Gene Symbol: VAMP2 Gene ID (NCBI): 6844 RRID: AB_2918585 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P63027 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924