Proteintech, 67825-1-Ig, Caspase 6 Monoclonal antibody

Size: 20ul / 150ul The Caspase 6 (67825-1-Ig) by Proteintech is a Monoclonal antibody targeting Caspase 6 in WB, IF/ICC, ELISA applications with reactivity to Human samples 67825-1-Ig targets Caspase 6 in WB, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: Jurkat cells Positive IF/ICC detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Caspase-6 belongs to caspase family of cysteinyl-aspartate specific proteases.Precursor of CASP6 produces two subunits, large (18kDa) and small (16kDa) that dimerize. It cleaves poly(ADP-ribose) polymerase, as well as lamins and is involved in the activation cascade of caspases responsible for apoptosis execution. Researches showed that CASP6 could be an early instigator of neuronal dysfunction and regulates B cell activation and differentiation into plasma cells by modifying cell cycle entry. IRAK3 is an important target for CASP6. It can reveal five bands of 28, 32, 36, 49, and 64 kDa in human neurons and fetal brain in western blot, the 32 and 28 kDa bands represent procaspase-6 and pro-arm caspase-6. Procaspase-6 is more abundant than pro-arm caspase-6 in adult tissue, whereas pro-arm caspase-6 is more abundant than pro-caspase-6 in fetal brain and cultured neurons. The higher molecular mass bands at 49 and 64 kDa likely represent dimers of p28 and p32.(PMID:10438520). In rat testis, it can be detected two bands of 34 kDa and 12 kDa or 14 kDa(PMID:12538628). Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag20534 Product name: Recombinant human Caspase 6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 59-222 aa of BC000305 Sequence: LTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRET Predict reactive species Full Name: caspase 6, apoptosis-related cysteine peptidase Calculated Molecular Weight: 33 kDa, 22 kDa Observed Molecular Weight: 33-35 kDa，22kDa, 18kDa GenBank Accession Number: BC000305 Gene Symbol: Caspase 6 Gene ID (NCBI): 839 RRID: AB_2918587 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P55212 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.