Proteintech, 67839-1-Ig, MED4 Monoclonal antibody

Size: 20ul / 150ul The MED4 (67839-1-Ig) by Proteintech is a Monoclonal antibody targeting MED4 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, Mouse, rat samples 67839-1-Ig targets MED4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Mouse, rat samples. Tested Applications Positive WB detected in: LNCaP cells, Hela, HEK-293, Jurkat, K-562, HSC-T6, PC-12, NIH/3T3, 4T1 Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information MED4 is a component of the Meditor complex, which is a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Meditor functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. It also have an alternative name called "Activator-recruited cofactor 36 kDa component (ARC36) ". Specification Tested Reactivity: Human, Mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8562 Product name: Recombinant human MED4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-270 aa of BC005189 Sequence: MAASSSGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDGDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKEDEDDVEIMSTDSSSSSSESD Predict reactive species Full Name: mediator complex subunit 4 Calculated Molecular Weight: 270 aa, 30 kDa Observed Molecular Weight: ~36 kDa GenBank Accession Number: BC005189 Gene Symbol: MED4 Gene ID (NCBI): 29079 RRID: AB_2918601 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NPJ6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.