Iright
BRAND / VENDOR: Proteintech

Proteintech, 67845-1-Ig, VAPA Monoclonal antibody

CATALOG NUMBER: 67845-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The VAPA (67845-1-Ig) by Proteintech is a Monoclonal antibody targeting VAPA in WB, IHC, ELISA applications with reactivity to Human, Mouse, Rat samples 67845-1-Ig targets VAPA in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, Neuro-2a cells Positive IHC detected in: human liver cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information VAPA (Vesicle-associated membrane protein-associated protein A), also known as VAP33, is a 33-kDa, ubiquitously expressed integral membrane protein of the VAMP-associated protein (VAP) family. It is present in the plasma membrane and in intracellular vesicles, playing a role in vesicle trafficking. Specification Tested Reactivity: Human, Mouse, Rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7819 Product name: Recombinant human VAPA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-221 aa of BC002992 Sequence: MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFR Predict reactive species Full Name: VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC002992 Gene Symbol: VAPA Gene ID (NCBI): 9218 RRID: AB_2918607 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9P0L0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924