Proteintech, 67847-1-Ig, PSMB1 Monoclonal antibody

Size: 20ul / 150ul The PSMB1 (67847-1-Ig) by Proteintech is a Monoclonal antibody targeting PSMB1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 67847-1-Ig targets PSMB1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, K-562 cells, THP-1 cells, U-937 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Positive FC (Intra) detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information PSMB1(Proteasome subunit beta type-1) is also named as PSC5 and belongs to the peptidase T1B family. The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The gene encodes a 241 amino acid protein with a 28 amino acid propeptide and two glycosylation sites. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30791 Product name: Recombinant human PSMB1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-241 aa of BC020807 Sequence: MLSSTAMYSAPGRDLGMEPHRAAGPLQLRFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD Predict reactive species Full Name: proteasome (prosome, macropain) subunit, beta type, 1 Calculated Molecular Weight: 241 aa, 26 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC020807 Gene Symbol: PSMB1 Gene ID (NCBI): 5689 RRID: AB_2918609 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P20618 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.