Proteintech, 67851-1-Ig, RUVBL2 Monoclonal antibody

Size: 20ul / 150ul The RUVBL2 (67851-1-Ig) by Proteintech is a Monoclonal antibody targeting RUVBL2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 67851-1-Ig targets RUVBL2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HSC-T6 cells, NIH/3T3 cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information RUVBL2 belongs to the conserved ATPases associated with various cellular activities (AAA+) protein subfamily, which is characterized by the presence of conserved Walker A and B motifs that are involved in ATP binding and hydrolysis. The AAA+ (ATPases associated with diverse cellular activities) ATPases, RUVBL1 and RUVBL2, were originally isolated as components of transcriptional complexes and shown to function in a number of different cellular processes, including transcriptional regulation, chromatin remodelling and DNA damage responses. (PMID: 31572066, PMID: 31138842) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag0253 Product name: Recombinant human RUVBL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 220-463 aa of BC000428 Sequence: SQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS Predict reactive species Full Name: RuvB-like 2 (E. coli) Calculated Molecular Weight: 51 kDa Observed Molecular Weight: 51 kDa GenBank Accession Number: BC000428 Gene Symbol: RUVBL2 Gene ID (NCBI): 10856 RRID: AB_2918610 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y230 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.