Proteintech, 67860-1-Ig, BCLAF1 Monoclonal antibody

Size: 20ul / 150ul The BCLAF1 (67860-1-Ig) by Proteintech is a Monoclonal antibody targeting BCLAF1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 67860-1-Ig targets BCLAF1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HEK-293 cells, LNCaP cells, HeLa cells, Jurkat cells, K-562 cells, HL-60 cells, HSC-T6 cells, NIH/3T3 cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension Background Information BCLF1, also named as Bcl-2-associated transcription factor 1, is a 920 amino acid protein, which Interacts with Bcl-2 related proteins, EMD, with the adenovirus E1B 19 kDa protein and with DNA. BCLF1 as a death-promoting transcriptional repressor may be involved in cyclin-D1/CCND1 mRNA stability through the SNARP complex which associates with both the 3'end of the CCND1 gene and its mRNA. The calculated molecular weight of BCLF1 is a 110 kDa, but the modified BCLF1 protein is about 140-150 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag25210 Product name: Recombinant human BCLAF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 881-920 aa of BC132780 Sequence: SGSSPKWTHDKYQGDGIVEDEEETMENNEEKKDRRKEEKE Predict reactive species Full Name: BCL2-associated transcription factor 1 Calculated Molecular Weight: 920 aa, 106 kDa Observed Molecular Weight: 145 kDa GenBank Accession Number: BC132780 Gene Symbol: BCLAF1 Gene ID (NCBI): 9774 RRID: AB_2918618 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9NYF8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.