Iright
BRAND / VENDOR: Proteintech

Proteintech, 67877-1-Ig, PLEKHB2 Monoclonal antibody

CATALOG NUMBER: 67877-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PLEKHB2 (67877-1-Ig) by Proteintech is a Monoclonal antibody targeting PLEKHB2 in WB, ELISA applications with reactivity to Human, pig samples 67877-1-Ig targets PLEKHB2 in WB, ELISA applications and shows reactivity with Human, pig samples. Tested Applications Positive WB detected in: Caco-2 cells, HT-29 cells, COLO320 cells, SW480 cells, NCCIT cells, BxPC-3 cells, U-87 MG cells, HL-60 cells, Pig colon tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information PLEKHB2, also named as EVT2 (Evectin-2), is involved in retrograde transport of recycling endosomes. PLEKHB2 has been identified as post-Golgi proteins of unknown function that have a PH domain that typically binds polyphosphoinositides. PLEKHB2 is expressed in a broad range of tissues. PLEKHB2 has some isoforms with MW 19-26 kDa and 34 kDa. This antibody recognizes all the isoforms of PLEKHB2. Specification Tested Reactivity: Human, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag9231 Product name: Recombinant human PLEKHB2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-201 aa of BC013991 Sequence: MAFVKSGWLLRQSTILKRWKKNWFDLWSDGHLIYYDDQTRQNIEDKVHMPMDCINIRTGQECRDTQPPDGKSKDCMLQIVCRDGKTISLCAESTDDCLAWKFTLQDSRTNTAYVGSAVMTDETSVVSSPPPYTAYAAPAPEQAYGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLYGQQPANQVIIRERYRDNDSDL Predict reactive species Full Name: pleckstrin homology domain containing, family B (evectins) member 2 Calculated Molecular Weight: 222 aa, 25 kDa Observed Molecular Weight: 19-25;30-34 kDa GenBank Accession Number: BC013991 Gene Symbol: PLEKHB2 Gene ID (NCBI): 55041 RRID: AB_2918634 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q96CS7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924