Proteintech, 67878-1-Ig, HBZ Monoclonal antibody

Size: 20ul / 150ul The HBZ (67878-1-Ig) by Proteintech is a Monoclonal antibody targeting HBZ in WB, ELISA applications with reactivity to human samples 67878-1-Ig targets HBZ in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information HBZ, also named as Zeta-globin and HBAZ, belongs to the globin family. HBZ is an alpha-type chain of mammalian embryonic hemoglobin, synthesized primarily in the yolk sac. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag11061 Product name: Recombinant human HBZ protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC027892 Sequence: MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR Predict reactive species Full Name: hemoglobin, zeta Calculated Molecular Weight: 142 aa, 16 kDa Observed Molecular Weight: 14-16 kDa GenBank Accession Number: BC027892 Gene Symbol: HBZ Gene ID (NCBI): 3050 RRID: AB_2918635 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P02008 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.