Proteintech, 67889-1-Ig, CDK7 Monoclonal antibody

Size: 20ul / 150ul The CDK7 (67889-1-Ig) by Proteintech is a Monoclonal antibody targeting CDK7 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, mouse, rat samples 67889-1-Ig targets CDK7 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, U2OS cells, MCF-7 cells, Hela cells, Jurkat cells, HEK-293 cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:750-1:3000 Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag25737 Product name: Recombinant human CDK7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 183-345 aa of BC005298 Sequence: LLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLI Predict reactive species Full Name: cyclin-dependent kinase 7 Calculated Molecular Weight: 39 kDa Observed Molecular Weight: 39 kDa GenBank Accession Number: BC005298 Gene Symbol: CDK7 Gene ID (NCBI): 1022 RRID: AB_2918645 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P50613 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.