Proteintech, 67892-1-Ig, KPNA3 Monoclonal antibody

Size: 20ul / 150ul The KPNA3 (67892-1-Ig) by Proteintech is a Monoclonal antibody targeting KPNA3 in WB, IHC, ELISA applications with reactivity to Human, rat, mouse samples 67892-1-Ig targets KPNA3 in WB, IHC, IF, ELISA applications and shows reactivity with Human, rat, mouse samples. Tested Applications Positive WB detected in: LNCaP cells, HSC-T6 cells, HepG2 cells, HeLa cells, Jurkat cells, K-562 cells, PC-12 cells, NIH/3T3 cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1500-1:6000 Background Information karyopherin subunit alpha 3 (KPNA3) is a member of the importin alpha family which can transport molecules between the mucleus and cytoplasm. It is ubiquitous expressed in brain,testis and esophagus. KPNA3 is associated with many severe diseases such as hepatocellular Carcinoma (PMID: 31417635) , schizophrenia, major depression and opiate dependence (PMID: 22960338) . The molecular weight of KPNA3 is about 58 kDa. Specification Tested Reactivity: Human, rat, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27767 Product name: Recombinant human KPNA3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 322-453 aa of BC017355 Sequence: VLNCDVLSHFPNLLSHPKEKINKEAVWFLSNITAGNQQQVQAVIDAGLIPMIIHQLAKGDFGTQKEAAWAISNLTISGRKDQVEYLVQQNVIPPFCNLLSVKDSQVVQVVLDGLKNILIMAGDEASTIAEII Predict reactive species Full Name: karyopherin alpha 3 (importin alpha 4) Calculated Molecular Weight: 58 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: BC017355 Gene Symbol: KPNA3 Gene ID (NCBI): 3839 RRID: AB_2918648 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O00505 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.