Iright
BRAND / VENDOR: Proteintech

Proteintech, 67912-1-Ig, PXR Monoclonal antibody

CATALOG NUMBER: 67912-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PXR (67912-1-Ig) by Proteintech is a Monoclonal antibody targeting PXR in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 67912-1-Ig targets PXR in WB, IHC, IF, FC (Intra), IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat liver tissue, COLO 320 cells, MCF-7 cells, mouse liver tissue Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension Background Information Pregnane X receptor (PXR; NR1I2), a member of the nuclear receptor superfamily, plays a key role in the induction of genes involved in drug transport and metabolism. It modulates drug transport and metabolism through the regulation of target genes responsible for the transport and conversion of chemicals into metabolites that are more easily eliminated from the body [PMID: 22609277]. It is also emerging as an endobiotic receptor that regulates the inflammatory response. In addition, PXR acts as a transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics, drugs and endogenous compounds [PMID: 19297428]. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7991 Product name: Recombinant human PXR protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 56-433 aa of BC017304 Sequence: MTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS Predict reactive species Full Name: nuclear receptor subfamily 1, group I, member 2 Calculated Molecular Weight: 50 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC017304 Gene Symbol: PXR Gene ID (NCBI): 8856 RRID: AB_2918667 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O75469 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924