Proteintech, 67915-1-Ig, DDX3 Monoclonal antibody

Size: 20ul / 150ul The DDX3 (67915-1-Ig) by Proteintech is a Monoclonal antibody targeting DDX3 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, rat samples 67915-1-Ig targets DDX3 in WB, IHC, IF, FC (Intra), CoIP, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: LNCaP cells, HepG2 cells, HeLa cells, HEK-293 cells, Jurkat cells, HSC-T6 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension Background Information DDX3X, also named DBX, DDX3, and HLP2, belongs to the DEAD-box helicase family and DDX3/DED1 subfamily. It is ATP-dependent RNA helicase. DDX3X acts as a cofactor for XPO1-mediated nuclear export of incompletely spliced HIV-1 Rev RNAs. It is also involved in HIV-1 replication. DDX3X interacts specifically with hepatitis C virus core protein resulting in a change in intracellular location. 73kd is the target band. 60-65kd is some other isoform. This antibody can bind both DDX3X and DDX3Y for the close sequences. Specification Tested Reactivity: human, rat Cited Reactivity: human, rat, hamster Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29972 Product name: Recombinant human DDX3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 312-662 aa of BC011819 Sequence: DLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAYEHHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGSSRGFGGGGYGGFYNSDGYGGNYNSQGVDWWGN Predict reactive species Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, X-linked Calculated Molecular Weight: 73 kDa Observed Molecular Weight: 71-73 kDa GenBank Accession Number: BC011819 Gene Symbol: DDX3 Gene ID (NCBI): 1654 RRID: AB_2918669 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O00571 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.