Proteintech, 67921-1-Ig, NUDT22 Monoclonal antibody

Size: 20ul / 150ul The NUDT22 (67921-1-Ig) by Proteintech is a Monoclonal antibody targeting NUDT22 in WB, ELISA, FC (Intra) applications with reactivity to Human, rat samples 67921-1-Ig targets NUDT22 in WB, ELISA, FC (Intra) applications and shows reactivity with Human, rat samples. Tested Applications Positive WB detected in: Jurkat cells, LNCaP cells, K-562 cells, HSC-T6 cells Positive FC (Intra) detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Human NUDT22 belongs to the diverse NUDIX family of proteins, is a Mg2+-dependent UDP-glucose and UDP-galactose hydrolase, producing UMP and glucose 1-phosphate or galactose 1-phosphate. Specification Tested Reactivity: Human, rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag14787 Product name: Recombinant human NUDT22 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-303 aa of BC006129 Sequence: MDPEVTLLLQCPGGGLPQEQIQAELSPAHDRRPLPGGDEAITAIWETRLKAQPWLFDAPKFRLHSATLAPIGSRGPQLLLRLGLTSYRDFLGTNWSSSAAWLRQQGATDWGDTQAYLADPLGVGAALATADDFLVFLRRSRQVAEAPGLVDVPGGHPEPQALCPGGSPQHQDLAGQLVVHELFSSVLQEICDEVNLPLLTLSQPLLLGIARNETSAGRASAEFYVQCSLTSEQVRKHYLSGGPEAHESTGIFFVETQNVRRLPETEMWAELCPSAKGAIILYNRVQGSPTGAALGSPALLPPL Predict reactive species Full Name: nudix (nucleoside diphosphate linked moiety X)-type motif 22 Calculated Molecular Weight: 303 aa, 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC006129 Gene Symbol: NUDT22 Gene ID (NCBI): 84304 RRID: AB_2918673 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9BRQ3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.