Iright
BRAND / VENDOR: Proteintech

Proteintech, 67929-1-Ig, SLC36A3 Monoclonal antibody

CATALOG NUMBER: 67929-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SLC36A3 (67929-1-Ig) by Proteintech is a Monoclonal antibody targeting SLC36A3 in WB, IHC, IF-P, ELISA applications with reactivity to Human, Mouse samples 67929-1-Ig targets SLC36A3 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: unboiled mouse testis tissue, COLO 320 cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Specification Tested Reactivity: Human, Mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag16556 Product name: Recombinant human SLC36A3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 84-190 aa of BC101092 Sequence: VLTVHCMVILLNCAQHLSQRLQKTFVNYGEATMYGLETCPNTWLRAHAVWGRWNLALSPRLECSGKISAHCNPHLQGSSNSPAQASRVAGIYRYTVSFLLVITQLGF Predict reactive species Full Name: solute carrier family 36 (proton/amino acid symporter), member 3 Calculated Molecular Weight: 511 aa, 56 kDa Observed Molecular Weight: 51 kDa GenBank Accession Number: BC101092 Gene Symbol: SLC36A3 Gene ID (NCBI): 285641 RRID: AB_2918681 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q495N2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924