Proteintech, 67931-1-Ig, PTPN9 Monoclonal antibody

Size: 20ul / 150ul The PTPN9 (67931-1-Ig) by Proteintech is a Monoclonal antibody targeting PTPN9 in WB, IF/ICC, ELISA applications with reactivity to Human, pig, mouse samples 67931-1-Ig targets PTPN9 in WB, IF/ICC, ELISA applications and shows reactivity with Human, pig, mouse samples. Tested Applications Positive WB detected in: MCF-7 cells, Jurkat cells, pig pancreas tissue, A549 cells, Hela cells, RAW 264.7 cells Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information PTPN9, Tyrosine-protein phosphatase non-receptor type 9, is a member of the protein tyrosine phosphatase (PTP) family. PTPs are signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. PTPN9 is involved in the transfer of hydrophobic ligands or in functions of the Golgi apparatus (PMID: 19167335). MiR-96 inhibits PTPN9 expression and consequently promotes proliferation, migration and invasion of breast cancer cells (PMID:27857177). Specification Tested Reactivity: Human, pig, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30615 Product name: Recombinant human PTPN9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 248-593 aa of BC010863 Sequence: FQFLPQVNGHPDPFDEIILFSLPPALDWDSVHVPGPHAMTIQELVDYVNARQKQGIYEEYEDIRRENPVGTFHCSMSPGNLEKNRYGDVPCLDQTRVKLTKRSGHTQTDYINASFMDGYKQKNAYIGTQGPLENTYRDFWLMVWEQKVLVIVMTTRFEEGGRRKCGQYWPLEKDSRIRFGFLTVTNLGVENMNHYKKTTLEIHNTEERQKRQVTHFQFLSWPDYGVPSSAASLIDFLRVVRNQQSLAVSNMGARSKGQCPEPPIVVHCSAGIGRTGTFCSLDICLAQLEELGTLNVFQTVSRMRTQRAFSIQTPEQYYFCYKAILEFAEKEGMVSSGQNLLAVESQ Predict reactive species Full Name: protein tyrosine phosphatase, non-receptor type 9 Calculated Molecular Weight: 593 aa, 68 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC010863 Gene Symbol: PTPN9 Gene ID (NCBI): 5780 RRID: AB_2918683 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P43378 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.