Iright
BRAND / VENDOR: Proteintech

Proteintech, 67938-1-Ig, PSMA3 Monoclonal antibody

CATALOG NUMBER: 67938-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PSMA3 (67938-1-Ig) by Proteintech is a Monoclonal antibody targeting PSMA3 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples 67938-1-Ig targets PSMA3 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, U2OS cells, Hela cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information PSMA3(Proteasome subunit alpha type-3) is also named as HC8, PSC8 and belongs to the peptidase T1A family. The proteasome is a multicatalytic protease complex that catalyzes an energy-dependent, extralysosomal proteolytic pathway responsible for selective elimination of proteins with aberrant structures and naturally occurring short-lived proteins related to metabolic regulation and cell cycle progression. It has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30552 Product name: Recombinant human PSMA3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-255 aa of BC029402 Sequence: MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADMAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM Predict reactive species Full Name: proteasome (prosome, macropain) subunit, alpha type, 3 Calculated Molecular Weight: 255 aa, 28 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC029402 Gene Symbol: PSMA3 Gene ID (NCBI): 5684 RRID: AB_2918690 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P25788 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924