Proteintech, 67944-1-Ig, FcRn Monoclonal antibody

Size: 20ul / 150ul The FcRn (67944-1-Ig) by Proteintech is a Monoclonal antibody targeting FcRn in WB, IHC, ELISA applications with reactivity to Human samples 67944-1-Ig targets FcRn in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HEK-293 cells, THP-1 cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:5000-1:20000 Background Information The neonatal Fc receptor for IgG (FcRn) is a membrane-associated receptor which acts as a key determinant of IgG homeostasis. FcRn is similar in structure to major histocompatibility class I molecules. It is a heterodimer composed of a alpha chain associated with β2-microglobulin. FcRn transfers IgG from the mother to the fetus across the placenta and the proximal small intestine. In addition, throughout life, FcRn protects IgG from degradation and thus regulates the serum half-life of IgG (PMID: 17703228). Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag31173 Product name: Recombinant human FCGRT protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 24-297 aa of BC008734 Sequence: AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS Predict reactive species Full Name: Fc fragment of IgG, receptor, transporter, alpha Calculated Molecular Weight: 40 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC008734 Gene Symbol: FcRn Gene ID (NCBI): 2217 RRID: AB_2918696 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P55899 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.