Proteintech, 67971-1-Ig, HAT1 Monoclonal antibody

Size: 20ul / 150ul The HAT1 (67971-1-Ig) by Proteintech is a Monoclonal antibody targeting HAT1 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 67971-1-Ig targets HAT1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: LNCaP cells, HEK-293 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells Positive IHC detected in: rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.4 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag1952 Product name: Recombinant human HAT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 241-419 aa of BC018682 Sequence: MLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMAIEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLAQE Predict reactive species Full Name: histone acetyltransferase 1 Calculated Molecular Weight: 419 aa, 50 kDa Observed Molecular Weight: 45-46 kDa GenBank Accession Number: BC018682 Gene Symbol: HAT1 Gene ID (NCBI): 8520 RRID: AB_2918721 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O14929 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.