Iright
BRAND / VENDOR: Proteintech

Proteintech, 67974-1-Ig, LIMK1 Monoclonal antibody

CATALOG NUMBER: 67974-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The LIMK1 (67974-1-Ig) by Proteintech is a Monoclonal antibody targeting LIMK1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 67974-1-Ig targets LIMK1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, SH-SY5Y cells, pig brain tissue, A431 cells, HEK-293 cells, rabbit brain tissue, rat brain tissue, mouse brain tissue Positive IHC detected in: mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information LIMK1,also named LIMK, belongs to the protein kinase superfamily and TKL Ser/Thr protein kinase family. LIMK1 is a protein kinase which regulates actin filament dynamics. Phosphorylates and inactivates the actin binding/depolymerizing factor cofilin, thereby stabilizing the actin cytoskeleton. Isoform 3 has a dominant negative effect on actin cytoskeletal changes. LIMK1 may be involved in brain development. The antibody has no cross-reaction with LIMK2. Specification Tested Reactivity: human, mouse, rat, pig, rabbit Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28862 Product name: Recombinant human LIMK1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 67-222 aa of BC152982 Sequence: DGQLFCKKDYWARYGESCHGCSEQITKGLVMVAGELKYHPECFICLTCGTFIGDGDTYTLVEHSKLYCGHCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASSHGKRGLSVSIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHVGDR Predict reactive species Full Name: LIM domain kinase 1 Calculated Molecular Weight: 647 aa, 73 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC152982 Gene Symbol: LIMK1 Gene ID (NCBI): 3984 RRID: AB_3085042 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P53667 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924