Proteintech, 67978-1-Ig, SPTBN1 Monoclonal antibody

Size: 20ul / 150ul The SPTBN1 (67978-1-Ig) by Proteintech is a Monoclonal antibody targeting SPTBN1 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat, rabbit, pig samples 67978-1-Ig targets SPTBN1 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat, rabbit, pig samples. Tested Applications Positive WB detected in: HeLa cells, mouse cerebellum tissue, HepG2 cells, Jurkat cells, pig brain, rabbit brain, rat brain, mouse brain, rat cerebellum Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information SPTBN1 is the non-erythrocytic form of β-spectrin or β-fodrin. Spectrins are members of the superfamily of F-actin cross linking proteins that are important as scaffolding proteins for protein sorting, cell adhesion, and migration. Reduced expression of SPTBN1 has been found to correlate with shorter survival of patients with hepatocellular cancer, pancreatic cancer and other malignancies of the gastrointestinal tract, suggesting tumor suppression ability of this protein. Specification Tested Reactivity: Human, mouse, rat, rabbit, pig Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag31713 Product name: Recombinant human SPTBN1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 633-820 aa of BC137282 Sequence: EMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAESPDVRGRLSGIEERYKE Predict reactive species Full Name: spectrin, beta, non-erythrocytic 1 Calculated Molecular Weight: 2364 aa, 275 kDa Observed Molecular Weight: 250-275 kDa GenBank Accession Number: BC137282 Gene Symbol: SPTBN1 Gene ID (NCBI): 6711 RRID: AB_2918727 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q01082 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.