Iright
BRAND / VENDOR: Proteintech

Proteintech, 67979-1-Ig, SMARCB1 Monoclonal antibody

CATALOG NUMBER: 67979-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SMARCB1 (67979-1-Ig) by Proteintech is a Monoclonal antibody targeting SMARCB1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 67979-1-Ig targets SMARCB1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: NCCIT cells, HepG2 cells, LNCaP cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells Positive IHC detected in: mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information SMARCB1 is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. This gene has been found to be a tumor suppressor and mutations in it have been associated with malignant rhabdoid tumors. Two transcript variants encoding different isoforms have been found for this gene. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28911 Product name: Recombinant human SMARCB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-164 aa of NM_003073 Sequence: MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTF Predict reactive species Full Name: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 Calculated Molecular Weight: 44 kDa Observed Molecular Weight: 40-45 kDa GenBank Accession Number: NM_003073 Gene Symbol: SMARCB1 Gene ID (NCBI): 6598 RRID: AB_2918728 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q12824 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924