Proteintech, 67984-1-Ig, NMT1 Monoclonal antibody

Size: 20ul / 150ul The NMT1 (67984-1-Ig) by Proteintech is a Monoclonal antibody targeting NMT1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 67984-1-Ig targets NMT1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: LNCaP cells, HeLa cells, L02 cells, PC-3 cells, SKOV-3 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells Positive IHC detected in: human breast cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information NMT1 is a N-myristoyltransferase responsible for the transfer of myristate from CoA to an amino-terminal glycine of many eukaryotic proteins, which facilitates the targeting of proteins to membrane surfaces and is essential for viability of the organism. Insertional mutagenesis of the Nmt1 gene in Saccharomyces cerevisiae causes recessive lethality. Humans and mice possess two distinct but structurally similar enzymes, NMT1 and NMT2, ubiquitously expressed in most human and mouse tissues. Western analysis revealed that there are 4 isoforms of NMT1 with apparent molecular masses ranging from 49 to 68 kDa. In cell fractionation studies, the 68-kDa NMT1 isoform and NMT2 were present in both membrane and cytoplasmic fractions, while the smaller NMT1 isoforms were predominantly cytoplasmic. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag20541 Product name: Recombinant human NMT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-301 aa of BC006569 Sequence: MADESETAVKPPAPPLPQMMEGNGNGHEHCSDCENEEDNSYNRGGLSPANDTGAKKKKKKQKKKKEKGSETDSAQDQPVKMNSLPAERIQEIQKAIELFSVGQGPAKTMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFTWDALDLGDRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLPQWHCGVRVVSSRKLVGFISAIPANIHIYDTEKKMVEINFLCVHKKLRSKRVAPVLIREITRRVHLEGIFQAVYTAGVVLPKPVGTCRYWHRSL Predict reactive species Full Name: N-myristoyltransferase 1 Calculated Molecular Weight: 496 aa, 57 kDa Observed Molecular Weight: 50-60 kDa GenBank Accession Number: BC006569 Gene Symbol: NMT1 Gene ID (NCBI): 4836 RRID: AB_2918733 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P30419 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.