Proteintech, 67985-1-Ig, MON1B Monoclonal antibody

Size: 20ul / 150ul The MON1B (67985-1-Ig) by Proteintech is a Monoclonal antibody targeting MON1B in WB, IF/ICC, ELISA applications with reactivity to Human samples 67985-1-Ig targets MON1B in WB, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: LNCaP cells, HeLa cells, A549 cells, HEK-293 cells, Jurkat cells, HepG2 cells, K-562 cells, SW480 cells, MCF-7 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Vacuolar fusion protein MON1 homolog B (MON1B) is also named as HSRG1, KIAA0872 and SAND2, and belongs to the MON1/SAND family. The membrane recruitment of MON1B, a homolog of yeast MON1 protein in mammals, is essential for vesicular fusion of early endosomes (PMID:26987402). Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag9920 Product name: Recombinant human MON1B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 199-547 aa of BC024277 Sequence: STLTRASVARIFAHKQNYDLRRLLAGSERTLDRLLDSMEQDPGALLLGAVRCVPLARPLRDALGALLRRCTAPGLALSVLAVGGRLITAAQERNVLAECRLDPADLQLLLDWVGAPAFAAGEAWAPVCLPRFNPDGFFYAYVARLDAMPVCLLLLGTQREAFHAMAACRRLVEDGMHALGAMRALGEAASFSNASSASAPAYSVQAVGAPGLRHFLYKPLDIPDHHRQLPQFTSPELEAPYSREEERQRLSDLYHRLHARLHSTSRPLRLIYHVAEKETLLAWVTSKFELYTCLSPLVTKAGAILVVTKLLRWVKKEEDRLFIRYPPKYSTPPATSTDQAAHNGLFTGL Predict reactive species Full Name: MON1 homolog B (yeast) Calculated Molecular Weight: 547 aa, 59 kDa Observed Molecular Weight: 59 kDa GenBank Accession Number: BC024277 Gene Symbol: MON1B Gene ID (NCBI): 22879 RRID: AB_2918734 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q7L1V2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.