Proteintech, 67990-1-Ig, MMP7 Monoclonal antibody

Size: 20ul / 150ul The MMP7 (67990-1-Ig) by Proteintech is a Monoclonal antibody targeting MMP7 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human samples 67990-1-Ig targets MMP7 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SKOV-3 cells, HT-29 cells, COLO 320 cells, A549 cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human pancreas cancer tissue Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag0550 Product name: Recombinant human MMP7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC003635 Sequence: MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSHVIEIMQKPRCGVPDVAEYSLFPN Predict reactive species Full Name: matrix metallopeptidase 7 (matrilysin, uterine) Calculated Molecular Weight: 29 kDa Observed Molecular Weight: 27-30 kDa GenBank Accession Number: BC003635 Gene Symbol: MMP7 Gene ID (NCBI): 4316 RRID: AB_2918739 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P09237 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.