Iright
BRAND / VENDOR: Proteintech

Proteintech, 67993-1-Ig, SLC30A2 Monoclonal antibody

CATALOG NUMBER: 67993-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SLC30A2 (67993-1-Ig) by Proteintech is a Monoclonal antibody targeting SLC30A2 in WB, IHC, ELISA applications with reactivity to Human, Mouse samples 67993-1-Ig targets SLC30A2 in WB, IHC, IF, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: MCF-7 cells, HaCaT cells, Caco-2 cells, HT-29 cells, HeLa cells, NCCIT cells, JAR cells, ATDC-5 cells Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Background Information SLC30A2, also named as the Zn transporter 2 gene (ZnT2), belongs to the cation diffusion facilitator (CDF) transporter (TC 2.A.4) family and SLC30A subfamily. It plays a role in the zinc ion transmembrane transport. Expression of SLC30A2 is restricted to secretory cells, such as acinar pancreatic cells, prostate epithelial cells, placental trophoblasts, Paneth cells, and mammary epithelial cells (MECs). SLC30A2 consists of six transmembrane domains with cytoplasmic N- and C-termini that contain numerous regulatory domains, and functions as a homo- or hetero- dimer to transport Zn into vesicles (PMID: 29476070 ). SLC30A2 has 2 isoforms with the molecular mass of 35 and 41 kDa. Specification Tested Reactivity: Human, Mouse Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8232 Product name: Recombinant human SLC30A2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 234-323 aa of BC006251 Sequence: KGVDFTAVRDLLLSVEGVEALHSLHIWALTVAQPVLSVHIAIAQNTDAQAVLKTASSRLQGKFHFHTVTIQIEDYSEDMKDCQACQGPSD Predict reactive species Full Name: solute carrier family 30 (zinc transporter), member 2 Calculated Molecular Weight: 323 aa, 35 kDa Observed Molecular Weight: 41 kDa GenBank Accession Number: BC006251 Gene Symbol: SLC30A2 Gene ID (NCBI): 7780 RRID: AB_2918742 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9BRI3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924