Proteintech, 68001-1-Ig, Alpha B Crystallin Monoclonal antibody

Size: 20ul / 150ul The Alpha B Crystallin (68001-1-Ig) by Proteintech is a Monoclonal antibody targeting Alpha B Crystallin in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples 68001-1-Ig targets Alpha B Crystallin in WB, IHC, IP, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: mouse eye tissue, rat eye tissue Positive IHC detected in: mouse eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information Alpha B-crystallin, encoded by CRYAB gene, is multifunctional, serving as both a major structural protein in the lens and a small heat-shock protein in other tissues in mammals. Alpha B-crystallin may contribute to the transparency and refractive index of the lens. Single nucleotide polymorphisms (SNPs) in the promoter region of CRYAB gene have been associated with in multiple sclerosis. Mutations in the CRYAB gene cause distinct clinical phenotypes including isolated posterior polar cataract, myofibrillar myopathy, cardiomyopathy, or a multisystemic disorder combining all these features. Impairment of alpha-B crystallin dimerization may be relevant to the pathogenesis of these disorders. Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8656 Product name: Recombinant human aB-Crystallin protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-175 aa of BC007008 Sequence: MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK Predict reactive species Full Name: crystallin, alpha B Calculated Molecular Weight: 175 aa, 20 kDa Observed Molecular Weight: 20-22 kDa GenBank Accession Number: BC007008 Gene Symbol: Alpha B Crystallin Gene ID (NCBI): 1410 RRID: AB_2918749 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P02511 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.