Iright
BRAND / VENDOR: Proteintech

Proteintech, 68024-1-Ig, SFXN1 Monoclonal antibody

CATALOG NUMBER: 68024-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SFXN1 (68024-1-Ig) by Proteintech is a Monoclonal antibody targeting SFXN1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 68024-1-Ig targets SFXN1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PC-3 cells, MCF-7 cells, LNCaP cells, HepG2 cells, HeLa cells, Jurkat cells, MOLT-4 cells, Rat brain tissue, Mouse brain tissue Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information SFXN1, the founding member of the SLC56 family, was identified by positional cloning of the mutation in the flexed-tail mouse model with sideroblastic anemia. SFXN1 was recently identified as a mitochondrial serine transporter essential for one-carbon (1C) metabolism, a process in which folate species are generated and used in biosynthetic pathways required for cell proliferation. In HEK293 cells, SFXN1 is the most abundant isoform among the SFXNs. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag2985 Product name: Recombinant human SFXN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-236 aa of BC020517 Sequence: MILIGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQWINQSFNAVVNYTNRSGDAPLTVNELGTAYVSATTGAVATALGLNALTKHVSPLIGRFVPFAAVAAANCINIPLMRQRELKVGIPVTDENGNRLGESANAAKQAITQVVVSRILMAAPGMAIPPFIMNTLEKKAFLKRFPWMSAPIQVGLVGFCLVFATPLCCALFPQKSSMSVTSLEAELQAKIQESHPELRRVYFNKGL Predict reactive species Full Name: sideroflexin 1 Calculated Molecular Weight: 35.6 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC020517 Gene Symbol: SFXN1 Gene ID (NCBI): 94081 RRID: AB_2918768 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9H9B4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924