Proteintech, 68027-1-Ig, GNAO1 Monoclonal antibody

Size: 20ul / 150ul The GNAO1 (68027-1-Ig) by Proteintech is a Monoclonal antibody targeting GNAO1 in WB, IHC, IF-P, ELISA applications with reactivity to Mouse, Rat, Rabbit, Pig, Chicken, Human samples 68027-1-Ig targets GNAO1 in WB, IHC, IF-P, ELISA applications and shows reactivity with Mouse, Rat, Rabbit, Pig, Chicken, Human samples. Tested Applications Positive WB detected in: pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue, chicken brain tissue, rat cerebellum tissue Positive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information GNAO1 gene encodes the α subunit of heterotrimeric guanine nucleotide-binding protein (Gi protein), a membrane protein widely expressed in the central nervous system involved in signal transduction (PMID: 30642806). GNAO1 belongs to the G-alpha family and G(i/o/t/z) subfamily. GNAO1 is highly expressed in brain and modulate neuronal excitability (PMID: 30838255). GNAO1 has 2 isoforms with the molecular mass of 40 kDa. Specification Tested Reactivity: Mouse, Rat, Rabbit, Pig, Chicken, Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag32045 Product name: Recombinant human GNAO1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-302 aa of BC030027 Sequence: MKIIHEDGFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYTGPNTYEDAAAYIQAQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY Predict reactive species Full Name: guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O Calculated Molecular Weight: 302 aa, 35 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC030027 Gene Symbol: GNAO1 Gene ID (NCBI): 2775 RRID: AB_2918770 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P09471 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.