Iright
BRAND / VENDOR: Proteintech

Proteintech, 68032-1-Ig, DUSP22 Monoclonal antibody

CATALOG NUMBER: 68032-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The DUSP22 (68032-1-Ig) by Proteintech is a Monoclonal antibody targeting DUSP22 in WB, IF/ICC, ELISA applications with reactivity to Human, Mouse, Rat, Rabbit samples 68032-1-Ig targets DUSP22 in WB, IF/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat, Rabbit samples. Tested Applications Positive WB detected in: rat brain tissue, rabbit brain tissue, mouse brain tissue Positive IF/ICC detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information DUSP22(Dual specificity protein phosphatase 22) is also named as JSP1, LMWDSP2, MKPX. It has been demonstrated to belong to a new subgroup of small DSPs anchored at the membranes by an N-terminal myristic acid moiety and DUSP22 play a regulatory role in the JNK or p38 MAPK pathways(PMID:17384676). It has 2 isoforms produced by alternative splicing with the molecular weight of 21 kDa and 23 kDa. Specification Tested Reactivity: Human, Mouse, Rat, Rabbit Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag9831 Product name: Recombinant human DUSP22 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-184 aa of BC022847 Sequence: MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL Predict reactive species Full Name: dual specificity phosphatase 22 Calculated Molecular Weight: 184 aa, 21 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC022847 Gene Symbol: DUSP22 Gene ID (NCBI): 56940 RRID: AB_2918774 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NRW4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924