Iright
BRAND / VENDOR: Proteintech

Proteintech, 68033-1-Ig, CD35 Monoclonal antibody

CATALOG NUMBER: 68033-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CD35 (68033-1-Ig) by Proteintech is a Monoclonal antibody targeting CD35 in IHC, IF-P, ELISA applications with reactivity to human samples 68033-1-Ig targets CD35 in IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue, human appendicitis tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:550-1:2200 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information CD35, also known as complement receptor type 1 (CR1) or C3b/C4b receptor, is a single-chain glycoprotein consisting of 30 repeating homologous protein domains known as short consensus repeats (~60 amino acids each) followed by transmembrane and cytoplasmic domains (PMID: 8765013). CD35 is variably expressed by granulocytes, monocytes, B cells, some T cells, erythrocytes, follicular dendritic cells, Langerhans cells, and glomerular podocytes (PMID: 19004497). CD35 acts as a receptor for C3b and C4b and plays important roles in the regulation of the complement cascade and clearance of immune complexes. A soluble form of CD35 has been found in plasma (PMID: 3156931). It has been reported that soluble CD35 is produced by a proteolytic cleavage in the C-terminal region of CD35 transmembrane domain (PMID: 9405292). Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30268 Product name: Recombinant human CR1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1740-1971 aa of NM_000573 Sequence: DEGFRLKGRSASHCVLAGMKALWNSSVPVCEQIFCPNPPAILNGRHTGTPFGDIPYGKEISYACDTHPDRGMTFNLIGESSIRCTSDPQGNGVWSSPAPRCELSVPAACPHPPKIQNGHYIGGHVSLYLPGMTISYICDPGYLLVGKGFIFCTDQGIWSQLDHYCKEVNCSFPLFMNGISKELEMKKVYHYGDYVTLKCEDGYTLEGSPWSQCQADDRWDPPLAKCTSRTHD Predict reactive species Full Name: complement component (3b/4b) receptor 1 (Knops blood group) Calculated Molecular Weight: 224 kDa GenBank Accession Number: NM_000573 Gene Symbol: CR1 Gene ID (NCBI): 1378 ENSEMBL Gene ID: ENSG00000203710 RRID: AB_2918775 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P17927 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924