Proteintech, 68045-1-Ig, SH3BP4 Monoclonal antibody

Size: 20ul / 150ul The SH3BP4 (68045-1-Ig) by Proteintech is a Monoclonal antibody targeting SH3BP4 in WB, ELISA applications with reactivity to Human samples 68045-1-Ig targets SH3BP4 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: Y79 cells, U2OS cells, A549 cells, HeLa cells, HepG2 cells, hTERT-RPE1 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag31238 Product name: Recombinant human SH3BP4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-193 aa of BC057396 Sequence: MAAQRIRAANSNGLPRCKSEGTLIDLSEGFSETSFNDIKVPSPSALLVDNPTPFGNAKEVIAIKDYCPTNFTTLKFSKGDHLYVLDTSGGEWWYAHNTTEMGYIPSSYVQPLNYRNSTLSDSGMIDNLPDSPDEVAKELELLGGWTDDKKVPGRMYSNNPFWNGVQTNPFLNGNVPVMPSLDELNPKSTVDLL Predict reactive species Full Name: SH3-domain binding protein 4 Calculated Molecular Weight: 963 aa, 108 kDa Observed Molecular Weight: 110 kDa GenBank Accession Number: BC057396 Gene Symbol: SH3BP4 Gene ID (NCBI): 23677 RRID: AB_2918787 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9P0V3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.