Proteintech, 68069-1-Ig, ARF1 Monoclonal antibody

Size: 20ul / 150ul The ARF1 (68069-1-Ig) by Proteintech is a Monoclonal antibody targeting ARF1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 68069-1-Ig targets ARF1 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: A431 cells, LNCaP cells, HeLa cells, HEK-293 cells, HepG2 cells, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue Positive IF/ICC detected in: MCF-7 cells, HeLa cells, A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information ADP-ribosylation factors (ARFs) are members of the ARF family of GTP-binding proteins of the Ras superfamily. ARFs bind and regulate GTP/GDP cycle by alternating between the active GTP-bound and inactive GDP-bound conformations. ARF family proteins are essential and ubiquitous in eukaryotes. Six highly conserved members of the family have been identified in mammalian cells. They function in vesicular traffic and actin remodelling and other bioprocesses in cells. The ARF1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. It mainly functions in coat recruitment.(PMID: 7759471, PMID: 16042562). Specification Tested Reactivity: human, mouse, rat, pig, rabbit Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28021 Product name: Recombinant human ARF1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-181 aa of BC009247 Sequence: MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK Predict reactive species Full Name: ADP-ribosylation factor 1 Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 18-21 kDa GenBank Accession Number: BC009247 Gene Symbol: ARF1 Gene ID (NCBI): 375 RRID: AB_2918810 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P84077 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.