Iright
BRAND / VENDOR: Proteintech

Proteintech, 68090-1-Ig, FBXW11 Monoclonal antibody

CATALOG NUMBER: 68090-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The FBXW11 (68090-1-Ig) by Proteintech is a Monoclonal antibody targeting FBXW11 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 68090-1-Ig targets FBXW11 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, LNCaP cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells Positive IHC detected in: human colon cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information FBXW11 (also known as HOS or β-TrCP2) is a member of F-box family proteins and plays critical role in regulating the ubiquitination of phosphorylated substrates. Abnormal expression of several FBXW11 is involved in the modulation of various biological events, such as cell cycle, differentiation, migration, inflammation, and apoptosis, through targeting multiple different substrates. For instance, FBXW11 could bind to the phosphorylated IκB and β-catenin, promoting their degradation via the ubiquitin-proteasome system. In addition, FBXW11 expression is markedly increased in mouse skin tumors and promotes tumor growth by activating the NF-κB signaling (PMID: 33640602). FBXW11 has 3 isoforms with the molecular mass of 58-62 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag3761 Product name: Recombinant human FBXW11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 216-529 aa of BC026213 Sequence: NLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR Predict reactive species Full Name: F-box and WD repeat domain containing 11 Calculated Molecular Weight: 542 aa, 61 kDa Observed Molecular Weight: 58-62 kDa GenBank Accession Number: BC026213 Gene Symbol: FBXW11 Gene ID (NCBI): 23291 RRID: AB_2918827 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9UKB1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924