Iright
BRAND / VENDOR: Proteintech

Proteintech, 68113-1-Ig, ADAM8 Monoclonal antibody

CATALOG NUMBER: 68113-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ADAM8 (68113-1-Ig) by Proteintech is a Monoclonal antibody targeting ADAM8 in WB, FC, ELISA applications with reactivity to human, pig samples 68113-1-Ig targets ADAM8 in WB, FC, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: human testis tissue, HaCaT cells, A431 cells, pig stomach tissue, pig pancreas tissue Positive FC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Flow Cytometry (FC): FC : 0.80 ug per 10^6 cells in a 100 µl suspension Background Information ADAM8 is a type I transmembrane (TM) glycoprotein consisting of an N-terminal prodomain, followed by a metalloproteinase-, disintegrin (DIS)-, cysteine-rich-, epidermal growth factor (EGF)-like- and TM domain and a cytoplasmic tail. Expression levels of ADAM8 in normal tissue are typically low and limited to a few distinct cell types in the lymphatic organs as components of the immune system, the central nervous system, bone, and the lung. This antibody can be used to detect endogenous ADAM8 with an apparent molecular weight of 90 kDa (the calculated MW ). ADAM8 also can be detectable as a band with a molecular weight (MW) of 98 kDa, slightly larger than the calculated MW (90 kDa) (PMID:11050116). Specification Tested Reactivity: human, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17262 Product name: Recombinant human ADAM8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 145-494 aa of BC115404 Sequence: EGGEGGRHAVYQAEHLLQTAGTCGVSDDSLGSLLGPRTAAVFRPRPGDSLPSRETRYVELYVVVDNAEFQMLGSEAAVRHRVLEVVNHVDKLYQKLNFRVVLVGLEIWNSQDRFHVSPDPSVTLENLLTWQARQRTRRHLHDNVQLITGVDFTGTTVGFARVSAMCSHSSGAVNQDHSKNPVGVACTMAHEMGHNLGMDHDENVQGCRCQERFEAGRCIMAGSIGSSFPRMFSDCSQAYLESFLERPQSVCLANAPDLSHLVGGPVCGNLFVERGEQCDCGPPEDCRNRCCNSTTCQLAEGAQCAHGTCCQECKVKPAGELCRPKKDMCDLEEFCDGRHPECPEDAFQEN Predict reactive species Full Name: ADAM metallopeptidase domain 8 Calculated Molecular Weight: 824 aa, 89 kDa Observed Molecular Weight: 90 kDa GenBank Accession Number: BC115404 Gene Symbol: ADAM8 Gene ID (NCBI): 101 RRID: AB_2923642 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P78325 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924