Proteintech, 68116-1-Ig, PGAM5 Monoclonal antibody

Size: 20ul / 150ul The PGAM5 (68116-1-Ig) by Proteintech is a Monoclonal antibody targeting PGAM5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 68116-1-Ig targets PGAM5 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: LNCaP cells, rabbit brain tissue, pig brain tissue, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells Positive IHC detected in: human liver cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information Phosphoglycerate mutase 5 (PGAM5) is a mitochondrial Serine (Ser)/Threonine (Thr) phosphatase normally located in the inner mitochondrial membrane. Upon mitochondrial dysfunction, PGAM5 recruits and dephosphorylates Drp1 at Ser-637, triggers its GTPase activity and promotes mitochondrial fission. PGAM5 regulates mitophagy by stabilizing PINK1 under stress conditions, which recruits E3 ubiquitin ligase PARKIN for degradation of the damaged mitochondria. PGAM5 can be cleaved and released to the cytoplasm through PARKIN, which activates Wnt signaling and induces mitochondrial biogenesis (PMID: 32439975). PGAM5 has 2 isoforms with the molecular mass of 28 and 32 kDa. Specification Tested Reactivity: human, mouse, rat, pig, rabbit Cited Reactivity: mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28195 Product name: Recombinant human PGAM5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-255 aa of BC008196 Sequence: MAFRQALQLAACGLAGGSAAVLFSAVAVGKPRAGGDAEPRPAEPPAWAGGARPGPGVWDPNWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRADARQEEDSYEIFICHANVIRYIVCSIPPLLSAGDFVVLGS Predict reactive species Full Name: phosphoglycerate mutase family member 5 Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC008196 Gene Symbol: PGAM5 Gene ID (NCBI): 192111 RRID: AB_2923645 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q96HS1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.