Proteintech, 68117-1-Ig, ME1 Monoclonal antibody

Size: 20ul / 150ul The ME1 (68117-1-Ig) by Proteintech is a Monoclonal antibody targeting ME1 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 68117-1-Ig targets ME1 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: A549 cells, pig brain tissue, HCT 116 cells, LNCaP cells, HeLa cells, rabbit brain tissue, rat brain tissue, mouse brain tissue Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension Background Information ME1(NADP-dependent malic enzyme) belongs to the malic enzymes family. This malic enzyme catalyzes the reversible oxidative decarboxylation of malate and is a link between the glycolytic pathway and the citric acid cycle. The reaction is L-malate plus NADP(+) to form pyruvate, CO(2), and NADPH. Specification Tested Reactivity: human, mouse, rat, pig, rabbit Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag9916 Product name: Recombinant human ME1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 226-572 aa of BC025246 Sequence: DEFMEAVSSKYGMNCLIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYDQILPDCYSWPEEVQKIQTKVDQ Predict reactive species Full Name: malic enzyme 1, NADP(+)-dependent, cytosolic Calculated Molecular Weight: 572 aa, 64 kDa Observed Molecular Weight: 55-64 kDa GenBank Accession Number: BC025246 Gene Symbol: ME1 Gene ID (NCBI): 4199 RRID: AB_2923646 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P48163 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.