Proteintech, 68122-1-Ig, PPP1CC Monoclonal antibody

Size: 20ul / 150ul The PPP1CC (68122-1-Ig) by Proteintech is a Monoclonal antibody targeting PPP1CC in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 68122-1-Ig targets PPP1CC in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: LNCaP cells, HEK-293 cells, HeLa cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells Positive IF/ICC detected in: HeLa cells, C2C12 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information PPP1CC, also named as PP-1G, belongs to the PPP phosphatase family and PP-1 subfamily. Protein phosphatase 1 (PP1) is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. It is involved in regulation of ionic conductances and long-term synaptic plasticity. PPP1CC may play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca2+/calmodulin dependent protein kinase II. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag32348 Product name: Recombinant human PPP1CC protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 206-323 aa of BC014073 Sequence: WSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK Predict reactive species Full Name: protein phosphatase 1, catalytic subunit, gamma isoform Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC014073 Gene Symbol: PPP1CC Gene ID (NCBI): 5501 RRID: AB_2923650 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P36873 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.