Proteintech, 68138-1-Ig, UBE2D1/2/3/4 Monoclonal antibody

Size: 20ul / 150ul The UBE2D1/2/3/4 (68138-1-Ig) by Proteintech is a Monoclonal antibody targeting UBE2D1/2/3/4 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 68138-1-Ig targets UBE2D1/2/3/4 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, LNCaP cells, HeLa cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Ubiquitination is a post-translational modification pathway or is part of the specific protein-degradation pathway by the 26S proteasome. Ubiquitination of a target protein involves multistep enzymatic reaction catalyzed by a cascade of enzymes including Ub-activating enzymes (E1s), Ub-conjugating enzymes (E2s) and Ub ligases (E3s) (PMID: 23542885). UBE2D family, which has 4 members named as UBE2D1/2/3/4, is an E2 ubiquitin-conjugating enzyme family in the ubiquitin-proteasome system. This antibody can recognize all the four members of UBE2D due to the high homology. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag2278 Product name: Recombinant human UBE2D3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-147 aa of BC003395 Sequence: MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM Predict reactive species Full Name: ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) Calculated Molecular Weight: 17 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC003395 Gene Symbol: UBE2D3 Gene ID (NCBI): 7323 RRID: AB_2923665 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P61077 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.