Proteintech, 68144-1-Ig, NDUFV1 Monoclonal antibody

Size: 20ul / 150ul The NDUFV1 (68144-1-Ig) by Proteintech is a Monoclonal antibody targeting NDUFV1 in WB, IHC, ELISA applications with reactivity to Human, pig, rabbit, rat, mouse samples 68144-1-Ig targets NDUFV1 in WB, IHC, ELISA applications and shows reactivity with Human, pig, rabbit, rat, mouse samples. Tested Applications Positive WB detected in: PC-12 cells, A549 cells, 4T1 cells, pig heart tissue, HeLa cells, HEK-293 cells, H9C2 cells, rabbit heart tissue Positive IHC detected in: human lung cancer tissue, mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information DUFV1(NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial) is also named as UQOR1,Complex I-51kD and belongs to the complex I 51 kDa subunit family. It is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. It has 2 isoforms produced by alternative splicing. Defects in NDUFV1 are a cause of Leigh syndrome (LS) and mitochondrial complex I deficiency (MT-C1D). Specification Tested Reactivity: Human, pig, rabbit, rat, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag32659 Product name: Recombinant human NDUFV1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 116-447 aa of BC015645 Sequence: NADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAGLIGKNACGSGYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPTTVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNHPCTVEEEMSVPLKELIEKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALVQAQTGLGTAAVIVMDRSTDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIEGHTICALGDGAAWPVQGLIRHFRPELE Predict reactive species Full Name: NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa Calculated Molecular Weight: 51 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC015645 Gene Symbol: NDUFV1 Gene ID (NCBI): 4723 RRID: AB_2923668 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P49821 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.