Iright
BRAND / VENDOR: Proteintech

Proteintech, 68148-1-Ig, EEF1G Monoclonal antibody

CATALOG NUMBER: 68148-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The EEF1G (68148-1-Ig) by Proteintech is a Monoclonal antibody targeting EEF1G in WB, IF/ICC, ELISA applications with reactivity to human, pig, rabbit samples 68148-1-Ig targets EEF1G in WB, IF/ICC, ELISA applications and shows reactivity with human, pig, rabbit samples. Tested Applications Positive WB detected in: U2OS cells, HeLa cells, MCF-7 cells, pig heart tissue, A549 cells, HEK-293 cells, rabbit heart tissue, pig brain tissue, rabbit brain tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Eukaryotic translation elongation factor 1 (EEF1G, synonym: EF1G) is a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases. Specification Tested Reactivity: human, pig, rabbit Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag0218 Product name: Recombinant human EEF1G protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 140-400 aa of BC006520 Sequence: GLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWR Predict reactive species Full Name: eukaryotic translation elongation factor 1 gamma Calculated Molecular Weight: 50 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC006520 Gene Symbol: EEF1G Gene ID (NCBI): 1937 RRID: AB_2923672 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P26641 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924