Proteintech, 68153-1-Ig, AIDA Monoclonal antibody

Size: 20ul / 150ul The AIDA (68153-1-Ig) by Proteintech is a Monoclonal antibody targeting AIDA in WB, IF/ICC, ELISA applications with reactivity to human samples 68153-1-Ig targets AIDA in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, COLO 320 cells, HepG2 cells, HT-29 cells, U2OS cells, K-562 cells Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information AIDA, also named as C1orf80, acts as a ventralizing factor during embryogenesis. It inhibits axin-mediated JNK activation by binding axin and disrupting axin homodimerization. It's highest expression in the heart and skeletal muscle. AIDA has three isoforms with MW 35 kDa, 16 kDa and 26 kDa. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag20597 Product name: Recombinant human AIDA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-306 aa of BC015535 Sequence: MSEVTRSLLQRWGASFRRGADFDSWGQLVEAIDEYQILARHLQKEAQAQHNNSEFTEEQKKTIGKIATCLELRSAALQSTQSQEEFKLEDLKKLEPILKNILTYNKEFPFDVQPVPLRRILAPGEEENLEFEEDEEEGGAGAGSPDSFPARVPGTLLPRLPSEPGMTLLTIRIEKIGLKDAGQCIDPYITVSVKDLNGIDLTPVQDTPVASRKEDTYVHFNVDIELQKHVEKLTKGAAIFFEFKHYKPKKRFTSTKCFAFMEMDEIKPGPIVIELYKKPTDFKRKKLQLLTKKPLYLHLHQTLHKE Predict reactive species Full Name: axin interactor, dorsalization associated Calculated Molecular Weight: 306 aa, 35 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC015535 Gene Symbol: AIDA Gene ID (NCBI): 64853 RRID: AB_2923676 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q96BJ3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.