Iright
BRAND / VENDOR: Proteintech

Proteintech, 68160-1-Ig, LANCL1 Monoclonal antibody

CATALOG NUMBER: 68160-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The LANCL1 (68160-1-Ig) by Proteintech is a Monoclonal antibody targeting LANCL1 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat, pig samples 68160-1-Ig targets LANCL1 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue Positive IP detected in: mouse brain tissue Positive IF/ICC detected in: U-251 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information LanCL1 ( also known as P40 or GRP69A), is homologous to bacterial lanthionine synthetase C (LanC) family, which is involved in the biosynthesis of antimicrobial peptides (lantibiotics). LanCL1 was identified as a reduced glutathione (GSH)-binding protein and primarily expressed in neural tissues and testis. Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag32665 Product name: Recombinant human LANCL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 100-399 aa of BC028685 Sequence: TKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAPGVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACKFAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL Predict reactive species Full Name: LanC lantibiotic synthetase component C-like 1 (bacterial) Calculated Molecular Weight: 399 aa, 45 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC028685 Gene Symbol: LANCL1 Gene ID (NCBI): 10314 RRID: AB_2923679 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O43813 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924